(data stored in ACNUC7421 zone)

EMBL: AB001488.MUTT

AB001488.MUTT        Location/Qualifiers
FT   CDS             21373..21822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /note="FUNCTION UNKNOWN, CONTAINS MUTT MOTIF, SIMILAR
FT                   PRODUCTS IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96590"
FT                   /protein_id="BAA19270.1"
FT                   /translation="MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAA
FT                   VREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGR
FT                   LPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK"
     MYTQGAFVIV LNESQQILLV KRKDVPLWDL PGGRVDPGES AEEAAVREIL EETGYNAALS        60
     AKIGVYQRPK FQDEQHLFFG SITGGQAMAD GTETAGLKWV SPGRLPLFMV PNRKRQINDF       120
     KNGAQDVNVT VKDSGLLAAI DLLKRRLGK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page