(data stored in ACNUC7421 zone)

EMBL: AB001488.RSBU

AB001488.RSBU        Location/Qualifiers
FT   CDS             54082..55089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /product="SIGMA FACTOR SIGB REGULATION PROTEIN RSBU"
FT                   /note="SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P40399"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:1W53"
FT                   /db_xref="PDB:2J6Y"
FT                   /db_xref="PDB:2J6Z"
FT                   /db_xref="PDB:2J70"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40399"
FT                   /protein_id="BAA19307.1"
FT                   /translation="MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPE
FT                   EIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLGTKVPQEEALDIGAISVPAKQMSGDYYHFVKDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNVDASMFITMFYANYNMDKHQFTYAS
FT                   AGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYKQFDQHLEKGDMIVLFSDGVTECRT
FT                   ENGFLERPDLQKLIEEHMCSSAQEMVKNIYDSLLKLQDFQLHDDFTLIVLRRKV"
     MDFREVIEQR YHQLLSRYIA ELTETSLYQA QKFSRKTIEH QIPPEEIISI HRKVLKELYP        60
     SLPEDVFHSL DFLIEVMIGY GMAYQEHQTL RGIQQEIKSE IEIAANVQQT LLGTKVPQEE       120
     ALDIGAISVP AKQMSGDYYH FVKDKESINI AIADVIGKGI PAALCMSMIK YAMDSLPETG       180
     IHPSQVLKNL NRVVEQNVDA SMFITMFYAN YNMDKHQFTY ASAGHEPGFY YSQKDNTFYD       240
     LEAKGLVLGI SQDYDYKQFD QHLEKGDMIV LFSDGVTECR TENGFLERPD LQKLIEEHMC       300
     SSAQEMVKNI YDSLLKLQDF QLHDDFTLIV LRRKV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page