(data stored in ACNUC7421 zone)

EMBL: AB001488.YDAB

AB001488.YDAB        Location/Qualifiers
FT   CDS             2484..3881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /note="SIMILAR TO ENZYMES WHICH ACT VIA AN ATP-DEPENDENT
FT                   COVALENT BINDING OF AMP TO THEIR SUBSTRATE."
FT                   /db_xref="GOA:P96575"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96575"
FT                   /protein_id="BAA19255.1"
FT                   /translation="METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAML
FT                   QKGIQKGDRVALLCKNGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF
FT                   YGAEFKEILDEVLPELSSLCVTMETGTAYETSAEFEALFAGPDHLPETEMVSPDDTALL
FT                   MFTSGTTGNPKRCMITHGGIYRYVKKSNSSIARMKGLRFLACHPIYHTSALICIMLGTF
FT                   AETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWEKHQTDLSSLVILMTGG
FT                   TKVPSSLISRYLDIGIPLAHGYGSTEAWGISTWTPDMGMDKAASAGKPVAGVKVKVEDP
FT                   LTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFRTGDSGYVDEDGFIFITG
FT                   RYKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPKAFIVKNGGQRITE
FT                   EDVIAFL"
     METLQHLILH DMPNSEEIEA VKSGDHTLTY KGYRKRINQL ANAMLQKGIQ KGDRVALLCK        60
     NGHPASTVMF AALEIGAVVV PVSWQLKPYE MTGILKASEP KAMFYGAEFK EILDEVLPEL       120
     SSLCVTMETG TAYETSAEFE ALFAGPDHLP ETEMVSPDDT ALLMFTSGTT GNPKRCMITH       180
     GGIYRYVKKS NSSIARMKGL RFLACHPIYH TSALICIMLG TFAETTFVFT KDQDPVHMLK       240
     VIEEEKIQTV MALPVFYTYL LEAWEKHQTD LSSLVILMTG GTKVPSSLIS RYLDIGIPLA       300
     HGYGSTEAWG ISTWTPDMGM DKAASAGKPV AGVKVKVEDP LTGEELPQGE IGEIVVHTPF       360
     LFKGYEDNPE ATAKVLQNGW FRTGDSGYVD EDGFIFITGR YKDVIIYGGD NVYPDQVEEV       420
     IQQIPGILET AVVGIPDPLY GEKPKAFIVK NGGQRITEED VIAFL                       465
//

If you have problems or comments...

PBIL Back to PBIL home page