(data stored in ACNUC7421 zone)

EMBL: AB001488.YDAR

AB001488.YDAR        Location/Qualifiers
FT   CDS             complement(24204..25481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaR"
FT                   /note="PROBABLE INTEGRAL MEMBRANE PROTEIN."
FT                   /db_xref="GOA:P96593"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96593"
FT                   /protein_id="BAA19273.1"
FT                   /translation="MMNKDITAQSPRSKAVQDALDGKIRGFRGLLPFLGPAFIAAIAYI
FT                   DPGNFATNISAGSKYGYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP
FT                   VSIGLWIQGELVIIATDLAEFIGAALGLYLLFGIPMLEASIIAAIGSFAILELQRRGYR
FT                   SLEAGIAGMLFVVVIAFALQTFFAKPDAVSVMKGLFVPAFHGTDSVLLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGKTDAERKKIFRFEFIDILIAMLIAGAINASMLIVAAALFFKNG
FT                   LFVEDLDVAFQQFGHLVSPMSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLY
FT                   VRRFITIIPPILIIASGVNPTTALVLSQVVLSFGIAFALIPLIMFTSNKRIMGSLINAK
FT                   WITVVSWLIAVLIVALNVFLIVDTFR"
     MMNKDITAQS PRSKAVQDAL DGKIRGFRGL LPFLGPAFIA AIAYIDPGNF ATNISAGSKY        60
     GYMLLWVILF SNIMALLIQS LSAKLGIATG KNLPEVAREE FPKPVSIGLW IQGELVIIAT       120
     DLAEFIGAAL GLYLLFGIPM LEASIIAAIG SFAILELQRR GYRSLEAGIA GMLFVVVIAF       180
     ALQTFFAKPD AVSVMKGLFV PAFHGTDSVL LAAGILGATV MPHAIYLHSA LTQRRVVGKT       240
     DAERKKIFRF EFIDILIAML IAGAINASML IVAAALFFKN GLFVEDLDVA FQQFGHLVSP       300
     MSAALFGIGL LVAGLSSSSV GTLSGDVIMQ GFINYRIPLY VRRFITIIPP ILIIASGVNP       360
     TTALVLSQVV LSFGIAFALI PLIMFTSNKR IMGSLINAKW ITVVSWLIAV LIVALNVFLI       420
     VDTFR                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page