(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBE

AB001488.YDBE        Location/Qualifiers
FT   CDS             complement(29709..30761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbE"
FT                   /note="SIMILAR TO C4-DICARBOXYLATE-BINDING PERIPLASMIC
FT                   PROTEIN OF RHODOBACTER CAPSULATUS."
FT                   /db_xref="GOA:P96600"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96600"
FT                   /protein_id="BAA19281.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQI
FT                   VFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNV
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKE
FT                   TTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELI
FT                   RELLELRKDS"
     MKSLLACLAL MIAGIATALF IGFHDHTGNK KIVYDDDQEG LQDQIVFKFS HVVAENTPKG        60
     LAANKFADLV NEKSGGKIKI EVFPNGSLYS DIEEIEALQN GDVQFIAPST SKLGMLSPEW       120
     GVLDLPYAFT DYNAVKKGLN GSIGTQLFDS LKKNQLKGLA YWTNGFKQIT TNQGPVKTPD       180
     DLKGQDLRIM QSDVIEDQFK LLGATPHQES FNSTFQLLEN NVVDGEENTI SNIYSKKFYN       240
     VQDYLTISSH GYLGYAVMTD EHFWKAQTPE TRRILTEAMK ETTEWNETYA EQMNKEQLEE       300
     IKKNSAIHIY ELSDKEKQEW MKRLDPVYRQ YEPIFGRELI RELLELRKDS                  350
//

If you have problems or comments...

PBIL Back to PBIL home page