(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBF

AB001488.YDBF        Location/Qualifiers
FT   CDS             30831..32438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbF"
FT                   /note="PROBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96601"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96601"
FT                   /protein_id="BAA19282.1"
FT                   /translation="MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKK
FT                   RLMNTARTVSEMTEVKEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVS
FT                   TSIGKKSEGADEEAAFAEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGI
FT                   ADILLHLKRDIAFIVVLTLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSM
FT                   NEGVIAIDNRLVITIFNEKAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEI
FT                   RVSGKVIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMN
FT                   KLHTIAGLIQLGKSEKALQLAFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELG
FT                   IAVHIDENSSLQQFPEHVDQHDIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDIL
FT                   AILIEDNGCGIEPTHMPRLYDKGFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQG
FT                   TSFSIVFPMKGEEAQHGS"
     MNKKKLSIRW KITILSYILV IFSFLIGGIV LIGNIQHTEE RELKKRLMNT ARTVSEMTEV        60
     KEALARKKQT EAVRHAVEEI RMINEADYIV VMDMNHIRYT HPVSTSIGKK SEGADEEAAF       120
     AEHIYFSEAK GEIGTAVRAF YPVKDQDLNQ IGVVLVGKTL PGIADILLHL KRDIAFIVVL       180
     TLGFGLAGSF LLARHIKKQM FQLEPHEIVR MYEERTATFH SMNEGVIAID NRLVITIFNE       240
     KAKQIFEVQG DLIGKVIWEV LKDSRLPEIV ERNKAVYNEE IRVSGKVIMS SRIPIVMKKK       300
     VIGAVAIFQD RTEAAKMAEE LTGVRNFVEA LRVQNHEHMN KLHTIAGLIQ LGKSEKALQL       360
     AFQASTEQEN VTEFLHRSIQ NDAAAGLLLS KIRRGRELGI AVHIDENSSL QQFPEHVDQH       420
     DIVVLLGNLI ENAFGSFETV QSEDKRIDIS IEQTDDILAI LIEDNGCGIE PTHMPRLYDK       480
     GFTVNKTGGT GYGLYLVKQI IDKGSGTIEV DSHAGQGTSF SIVFPMKGEE AQHGS            535
//

If you have problems or comments...

PBIL Back to PBIL home page