(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBH

AB001488.YDBH        Location/Qualifiers
FT   CDS             33229..34494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbH"
FT                   /note="PROBABLE C4-DICARBOXYLATE TRANSPORT PROTEIN."
FT                   /db_xref="GOA:P96603"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96603"
FT                   /protein_id="BAA19284.1"
FT                   /translation="MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKM
FT                   VIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLD
FT                   YSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAA
FT                   LGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMS
FT                   VYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYG
FT                   CSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGA
FT                   AGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSE
FT                   NEFDEAKSIEAVEGMKKMKTAV"
     MKLFKNLTVQ VITAVIIGVI VGLVWPDVGK EMKPLGDTFI NAVKMVIAPI IFFTIVLGIA        60
     KMGDMKKVGK VGGKAFIYFE VVTTLALIIG LFVVNIMKPG AGLDYSKLEK GDVSQYTQNG       120
     GQGIDWIEFI THIVPSNMVD AFAKGDILQV LFFSILFGVG LAALGEKGKS VIDFFDKVSH       180
     VFFKIIGYIM RAAPIGAFGA MAYTIGHFGL DSIKPLASLM MSVYITMFLF VFVALNIICK       240
     LYGFSLWNYL RFIKDELLIV LGTSSSESVL PRMMDKMERY GCSKSVVGLV IPTGYSFNLD       300
     GTSIYLSMAT VFLAQVFGVD LSIGQQITII LVLMLTSKGA AGVTGSGFIV LASTLSALQV       360
     IPLEGLALLL GVDRFMSEGR AIVNLIGNGI ATIIVAKSEN EFDEAKSIEA VEGMKKMKTA       420
     V                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page