(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBK

AB001488.YDBK        Location/Qualifiers
FT   CDS             36917..37657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbK"
FT                   /note="PROBABLE MEMBRANE SPANNING PROTEIN."
FT                   /db_xref="GOA:P96606"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96606"
FT                   /protein_id="BAA19287.1"
FT                   /translation="MKLFNRKVTLVSLILMAVFQFFMALIIKRIVISAGTDENFIGYLS
FT                   YTPSLNILLQALTIVIAATIVSMEFDKKTIKFLLIRPVKRQKVFWSKLITVVMVSFYLY
FT                   LAYYILALLFGLLFFGTSVTAESKTLLVNTLALIGSNWLEAVMMGLFGLLCSSLFRNSA
FT                   VAVVVSFVVLYGASTLVQLMKLFENKWGSFLLFANTDFTQYRSGETALFSGMTPLFSIG
FT                   ILIIHAIFFIVVGWWCFCKRDVRV"
     MKLFNRKVTL VSLILMAVFQ FFMALIIKRI VISAGTDENF IGYLSYTPSL NILLQALTIV        60
     IAATIVSMEF DKKTIKFLLI RPVKRQKVFW SKLITVVMVS FYLYLAYYIL ALLFGLLFFG       120
     TSVTAESKTL LVNTLALIGS NWLEAVMMGL FGLLCSSLFR NSAVAVVVSF VVLYGASTLV       180
     QLMKLFENKW GSFLLFANTD FTQYRSGETA LFSGMTPLFS IGILIIHAIF FIVVGWWCFC       240
     KRDVRV                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page