(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBN

AB001488.YDBN        Location/Qualifiers
FT   CDS             complement(39385..39564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbN"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN, SIMILAR
FT                   TO SENS_BACSU."
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96609"
FT                   /protein_id="BAA19290.1"
FT                   /translation="MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRI
FT                   DRKHQKNLQEQNNT"
     MNTNMSGGRR SMPKRKVKTY QQLIQENKEA IMGNPKLMNV IYDRIDRKHQ KNLQEQNNT         59
//

If you have problems or comments...

PBIL Back to PBIL home page