(data stored in ACNUC7421 zone)

EMBL: AB001488.YDCM

AB001488.YDCM        Location/Qualifiers
FT   CDS             complement(63860..64369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcM"
FT                   /note="SIMILAR TO IMMUNITY REGION PROTEIN IN BACTERIOPHAGE
FT                   PHI-105."
FT                   /db_xref="GOA:P96630"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96630"
FT                   /protein_id="BAA19319.1"
FT                   /translation="MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQA
FT                   NGLLQHDKATDQYLIHINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEH
FT                   QASLFASELILTDKMLNEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSH
FT                   EISAFG"
     MITIYTSKGI KHKVQSVIKT HGTNNVYEIC DIQKIYILKN DLGQANGLLQ HDKATDQYLI        60
     HINENLQHQQ FVIAHELGHY FLHKRLNTFK VVNCSKVLKD KLEHQASLFA SELILTDKML       120
     NEALPYIQGF SKEQIAAYFN VPSFVTDYKL SQIGSFSNRI YSHEISAFG                   169
//

If you have problems or comments...

PBIL Back to PBIL home page