(data stored in ACNUC7421 zone)

EMBL: AB001488.YDCN

AB001488.YDCN        Location/Qualifiers
FT   CDS             complement(64366..64749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcN"
FT                   /note="PROBABLE REPRESSOR PROTEIN."
FT                   /db_xref="GOA:P96631"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96631"
FT                   /protein_id="BAA19320.1"
FT                   /translation="MSLGKRLKEARQKAGYTQKEAAEKLNIGNNNLSNYERDYRDPDTD
FT                   TLLKLSNLYNVSTDYLLGKDEVSKKNETDLLNKTINEAIQELKDEDTLLFMNDGEFDEE
FT                   TARLVKKALKNGIKFIDELKKKE"
     MSLGKRLKEA RQKAGYTQKE AAEKLNIGNN NLSNYERDYR DPDTDTLLKL SNLYNVSTDY        60
     LLGKDEVSKK NETDLLNKTI NEAIQELKDE DTLLFMNDGE FDEETARLVK KALKNGIKFI       120
     DELKKKE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page