(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDL

AB001488.YDDL        Location/Qualifiers
FT   CDS             80542..81717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddL"
FT                   /note="PROBABLE PROTEIN ASP-PHOSPHATASE."
FT                   /db_xref="GOA:P96649"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4I1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96649"
FT                   /protein_id="BAA19338.1"
FT                   /translation="MRGVFLDKDKIPYDLVTKKLNEWYTSIKNDQVEQAEIIKTEVEKE
FT                   LLNMEENQDALLYYQLLEFRHEIMLSYMKSKEIEDLNNAYETIKEIEKQGQLTGMLEYY
FT                   FYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSM
FT                   NYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHL
FT                   IAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNV
FT                   ALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENF
FT                   SIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKGEIIDENQPDSIGSSDFK"
     MRGVFLDKDK IPYDLVTKKL NEWYTSIKND QVEQAEIIKT EVEKELLNME ENQDALLYYQ        60
     LLEFRHEIML SYMKSKEIED LNNAYETIKE IEKQGQLTGM LEYYFYFFKG MYEFRRKELI       120
     SAISAYRIAE SKLSEVEDEI EKAEFFFKVS YVYYYMKQTY FSMNYANRAL KIFREYEEYA       180
     VQTVRCQFIV AGNLIDSLEY ERALEQFLKS LEISKESNIE HLIAMSHMNI GICYDELKEY       240
     KKASQHLILA LEIFEKSKHS FLTKTLFTLT YVEAKQQNYN VALIYFRKGR FIADKSDDKE       300
     YSAKFKILEG LFFSDGETQL IKNAFSYLAS RKMFADVENF SIEVADYFHE QGNLMLSNEY       360
     YRMSIEARRK IKKGEIIDEN QPDSIGSSDF K                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page