(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDO

AB001488.YDDO        Location/Qualifiers
FT   CDS             84737..85147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddO"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC."
FT                   /db_xref="GOA:P96652"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96652"
FT                   /protein_id="BAA19341.1"
FT                   /translation="MIDEIDKKILDELSKNSRLTMKKLGEKVHLTAPATASRVVKLIDN
FT                   GIIKGCSIEVNQVKLGFSIHAFLNIYIEKIHHQPYLAFIETQDNYVINNYKVSGDGCYL
FT                   LECKFPSNEVLDQFLNDLNKHANYKVSIVIGK"
     MIDEIDKKIL DELSKNSRLT MKKLGEKVHL TAPATASRVV KLIDNGIIKG CSIEVNQVKL        60
     GFSIHAFLNI YIEKIHHQPY LAFIETQDNY VINNYKVSGD GCYLLECKFP SNEVLDQFLN       120
     DLNKHANYKV SIVIGK                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page