(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDP

AB001488.YDDP        Location/Qualifiers
FT   CDS             complement(85270..85719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddP"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC AND LRP."
FT                   /db_xref="GOA:P96653"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96653"
FT                   /protein_id="BAA19342.1"
FT                   /translation="MQIDSIDFQILQLLNKNARIQWKEIGEKIHMTGQAVGNRIKKMED
FT                   NGIIKAYSIVVDELKMGFSFTAFVFFFMNAYMHDDLLKFIATRNEISEAHRVSGDACYL
FT                   LKVTVHSQEVLNHLLNDLLKYGNYQLYLSIKEVKKHYNTSLMSDE"
     MQIDSIDFQI LQLLNKNARI QWKEIGEKIH MTGQAVGNRI KKMEDNGIIK AYSIVVDELK        60
     MGFSFTAFVF FFMNAYMHDD LLKFIATRNE ISEAHRVSGD ACYLLKVTVH SQEVLNHLLN       120
     DLLKYGNYQL YLSIKEVKKH YNTSLMSDE                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page