(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDS

AB001488.YDDS        Location/Qualifiers
FT   CDS             87887..89197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddS"
FT                   /note="PROBABLE METABOLITE TRANSPORT PROTEIN, SIMILAR
FT                   PRODUCT IN E. COLI."
FT                   /db_xref="GOA:P96656"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96656"
FT                   /protein_id="BAA19345.1"
FT                   /translation="MVMTKKDTNISTQQPLWLQGYIDSPEKQNQLYKKTLKILIFSQIF
FT                   GGAGLGAGITVGALLAQDMIGSENVAGIPTALFTFGSAVAALLIGASSQRFGRRAGLAG
FT                   GFLIGGLGAIGVIIAALINSVALLFVSLLIYGAGMASNLQVRYAGTDLANEKQRATAAS
FT                   MALVSTTLGAVVGPNLVNTMGEFADSIGVPNLAGPFIMSGAAFIIAGIILLIFLRPDPL
FT                   FVSTAIANAEKKDDKVQIGGSLKNPAIDKKGIMVGAVIMILAQLIMTAIMTMTPVHMGH
FT                   HGHGLSEVGLVIGLHIAAMYLPSPLTGLLVDKFGRTTMAIASGATLLAAGLVAAIAPAD
FT                   SLSLLILALVLLGVGWNFGLLTGTALIIDSTHPSLRAKTQGTFDVLLALSGAAGGALSG
FT                   MVVAHSSYTILSISGAVLSLLLIPVVIWYFRRIQEKA"
     MVMTKKDTNI STQQPLWLQG YIDSPEKQNQ LYKKTLKILI FSQIFGGAGL GAGITVGALL        60
     AQDMIGSENV AGIPTALFTF GSAVAALLIG ASSQRFGRRA GLAGGFLIGG LGAIGVIIAA       120
     LINSVALLFV SLLIYGAGMA SNLQVRYAGT DLANEKQRAT AASMALVSTT LGAVVGPNLV       180
     NTMGEFADSI GVPNLAGPFI MSGAAFIIAG IILLIFLRPD PLFVSTAIAN AEKKDDKVQI       240
     GGSLKNPAID KKGIMVGAVI MILAQLIMTA IMTMTPVHMG HHGHGLSEVG LVIGLHIAAM       300
     YLPSPLTGLL VDKFGRTTMA IASGATLLAA GLVAAIAPAD SLSLLILALV LLGVGWNFGL       360
     LTGTALIIDS THPSLRAKTQ GTFDVLLALS GAAGGALSGM VVAHSSYTIL SISGAVLSLL       420
     LIPVVIWYFR RIQEKA                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page