(data stored in ACNUC7421 zone)

EMBL: AB001488.YDER

AB001488.YDER        Location/Qualifiers
FT   CDS             complement(110164..111351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeR"
FT                   /note="PROBABLE INTEGRAL MEMBRANE PROTEIN, SIMILAR TO
FT                   CHLORAMPHENICOL RESISTANCE PROTEIN OF STREPTOMYCES
FT                   VENEZUELAE."
FT                   /db_xref="GOA:P96675"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96675"
FT                   /protein_id="BAA19365.1"
FT                   /translation="MANGNKQAGQRISPSLTLLLATACGIIVANLYYAQPLVGLISKAI
FT                   GLSPSGAGLIVTLTQIGYVAGLLFLVPLGDIIENKKLIVVSLLLSAAALTLTAFVKHGT
FT                   LFLAAAFFVGLGSIAAQVLVPFASYLASDAARGRVVGNVMSGLLLGIMLSRPISSLVAD
FT                   IWGWNAIFALSAVVSVILAIVLSKVLPARKPTANTNYTALLGSMWKLLRTTPVLRRRAI
FT                   YHAFVFGAFSLFWTTVPLLLSGPDFHFSQKAIALYALVGIAGAVTAPIGGRLADRGLTR
FT                   LATGIALGVVVVSLLLPLMIQSSSPVGITVLVAAAILLDMGVSANLVLSQRAIFSLAPE
FT                   IRSRLNGLFMAIFFLGGAIGSSIGGWAYASGGWSTALWIGIAFPVIALLYFITEK"
     MANGNKQAGQ RISPSLTLLL ATACGIIVAN LYYAQPLVGL ISKAIGLSPS GAGLIVTLTQ        60
     IGYVAGLLFL VPLGDIIENK KLIVVSLLLS AAALTLTAFV KHGTLFLAAA FFVGLGSIAA       120
     QVLVPFASYL ASDAARGRVV GNVMSGLLLG IMLSRPISSL VADIWGWNAI FALSAVVSVI       180
     LAIVLSKVLP ARKPTANTNY TALLGSMWKL LRTTPVLRRR AIYHAFVFGA FSLFWTTVPL       240
     LLSGPDFHFS QKAIALYALV GIAGAVTAPI GGRLADRGLT RLATGIALGV VVVSLLLPLM       300
     IQSSSPVGIT VLVAAAILLD MGVSANLVLS QRAIFSLAPE IRSRLNGLFM AIFFLGGAIG       360
     SSIGGWAYAS GGWSTALWIG IAFPVIALLY FITEK                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page