(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFA

AB001488.YDFA        Location/Qualifiers
FT   CDS             113107..114414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfA"
FT                   /note="SIMILAR TO ARSENICAL PUMP MEMBRANE PROTEIN."
FT                   /db_xref="GOA:P96678"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96678"
FT                   /protein_id="BAA19368.1"
FT                   /translation="MTSMILAVFIFLLTLVLVIWQPKNLSIGWSACGGAVLALIAGVVN
FT                   FHDVLTVTGIVWNATLAFVAIILISLILDNIGFFEWAALHMAKAAKGYGVRMFVYVSLL
FT                   GAIVAALFANDGAALILTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPFVVSNLV
FT                   NIVSADYFHITFIDYASRMVVPYLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIK
FT                   DQNMFRLSWYILGLLLIGYFASEFFSIPVSVVAGSIAIIFLIAAQKSPAVHTKKVVKEA
FT                   PWAIVFFSIGMYVVVYGVRNAGLTDVLSDVIQAAADQGLFAGTIGMGFIAAILSSIMNN
FT                   LPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSHKGMK
FT                   ISWGTYFKTGIILTIPTLLITLVGLYIWLLIIHSCF"
     MTSMILAVFI FLLTLVLVIW QPKNLSIGWS ACGGAVLALI AGVVNFHDVL TVTGIVWNAT        60
     LAFVAIILIS LILDNIGFFE WAALHMAKAA KGYGVRMFVY VSLLGAIVAA LFANDGAALI       120
     LTPIVLAMVR ALHFNEKLVF PFIIASGFIA DTTSLPFVVS NLVNIVSADY FHITFIDYAS       180
     RMVVPYLFSL LASIIVLYLF FRKSIPKRYD LTEVKKPVEA IKDQNMFRLS WYILGLLLIG       240
     YFASEFFSIP VSVVAGSIAI IFLIAAQKSP AVHTKKVVKE APWAIVFFSI GMYVVVYGVR       300
     NAGLTDVLSD VIQAAADQGL FAGTIGMGFI AAILSSIMNN LPTVMIDALA IAGTDTHGMM       360
     REALIYANVI GSDLGPKITP IGSLATLLWL HVLSHKGMKI SWGTYFKTGI ILTIPTLLIT       420
     LVGLYIWLLI IHSCF                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page