(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFH

AB001488.YDFH        Location/Qualifiers
FT   CDS             120962..122185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfH"
FT                   /note="POBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96685"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96685"
FT                   /protein_id="BAA19375.1"
FT                   /translation="MLIRNPFKDKYYSHDRRALNMLALRVPGLAFILMIYIASIVLQFV
FT                   SGGWSILLLYAFTILIAIFALLHWHSYRWVKKRVILYFAVQGLITFALANLMTGFFILV
FT                   IIGLYAFLIGQIIGMADRRRTFLILYLLLLLVINSAYHLHKGEVLHFIVIAAPIMIVII
FT                   TYAATFFAQVDEKIKAQLTLERLELAHQQVEQLTLQNERQRMARDLHDTLAQGLVSLNM
FT                   QLDAIHVHLAKGNTERAKEIIQQSMKRVKSTIADARSAIDDLRSKSEEIGVLKERITSL
FT                   MDHFIESTGMACLLDYRLHQVLDVRTAENCYYIIGECMTNAAKHAEAKTIWISIWDDEK
FT                   GRLHLTVKDNGKGFDVEKGKKKRGHYGLLGIQERVRAINGQFNIKSTKLKGTQIEITVP
FT                   IQGEMQDE"
     MLIRNPFKDK YYSHDRRALN MLALRVPGLA FILMIYIASI VLQFVSGGWS ILLLYAFTIL        60
     IAIFALLHWH SYRWVKKRVI LYFAVQGLIT FALANLMTGF FILVIIGLYA FLIGQIIGMA       120
     DRRRTFLILY LLLLLVINSA YHLHKGEVLH FIVIAAPIMI VIITYAATFF AQVDEKIKAQ       180
     LTLERLELAH QQVEQLTLQN ERQRMARDLH DTLAQGLVSL NMQLDAIHVH LAKGNTERAK       240
     EIIQQSMKRV KSTIADARSA IDDLRSKSEE IGVLKERITS LMDHFIESTG MACLLDYRLH       300
     QVLDVRTAEN CYYIIGECMT NAAKHAEAKT IWISIWDDEK GRLHLTVKDN GKGFDVEKGK       360
     KKRGHYGLLG IQERVRAING QFNIKSTKLK GTQIEITVPI QGEMQDE                     407
//

If you have problems or comments...

PBIL Back to PBIL home page