(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFJ

AB001488.YDFJ        Location/Qualifiers
FT   CDS             122935..125109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfJ"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR TO ANTIBIOTIC
FT                   TRANSPORT-ASSOCIATED PROTEIN ACTII IN STREPTOMYCES
FT                   COELICOLOR."
FT                   /db_xref="GOA:P96687"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96687"
FT                   /protein_id="BAA19377.1"
FT                   /translation="MSKMLYTLGGWVARNRIKAICAWIVVLVAAIGLAVTLKPSFSEDM
FT                   SIPDTPSEKAMDVIQKEFPHGPDKGSIRVIFGAGDGEKLTGKPAKKAIEDTFKEISKDD
FT                   SVDSIASPFVTGTIAKDGTVAYADIQYKSSADDIKDYSIKHLKDSLKMADDEGLQTELS
FT                   GDVPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQ
FT                   VFDIASVSLSLAGMIGLAVGIDYALFIFTKHRQFLGEGIQKNESIARAVGTAGSAVVFA
FT                   GLTVIVALCGLTVVNIPFMSAMGLTAGLSVLMAVLASITLVPAVLSIAGKRMIPKSNKK
FT                   IEKQSTETNVWGRFVTKNPIMLSVCSILILIVISIPSMHLELGLPDAGMKAKDNPDRRA
FT                   YDLLAEGFGEGFNGQLTIVADATNATENKAEAFADAVKEIKGLDHVASVTPAMPNKEGN
FT                   FAIITVVPETGPNDVTTKDLVHDVRSLSDKNGVDLLVTGSTAVNIDISDRLNDAIPVFA
FT                   VLIVGFAFVLLTIVFRSLLVPLVAVAGFMLTMTATLGICVFVLQDGNLIDFFKIPEKGP
FT                   ILAFLPILSIGILFGLAMDYQVFLVSRMREEYVKTNNPVQAIQAGLKHSGPVVTAAGLI
FT                   MIFVFAGFIFAGEASIKANGLALSFGVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDK
FT                   IIPNVDIEGHQLTKEIQPEIDHEQKKQISV"
     MSKMLYTLGG WVARNRIKAI CAWIVVLVAA IGLAVTLKPS FSEDMSIPDT PSEKAMDVIQ        60
     KEFPHGPDKG SIRVIFGAGD GEKLTGKPAK KAIEDTFKEI SKDDSVDSIA SPFVTGTIAK       120
     DGTVAYADIQ YKSSADDIKD YSIKHLKDSL KMADDEGLQT ELSGDVPGAE MEIGGVSEIV       180
     GIILAFVVLA ITFGSLLIAG LPILTALIGL GVSIGLVLIG TQVFDIASVS LSLAGMIGLA       240
     VGIDYALFIF TKHRQFLGEG IQKNESIARA VGTAGSAVVF AGLTVIVALC GLTVVNIPFM       300
     SAMGLTAGLS VLMAVLASIT LVPAVLSIAG KRMIPKSNKK IEKQSTETNV WGRFVTKNPI       360
     MLSVCSILIL IVISIPSMHL ELGLPDAGMK AKDNPDRRAY DLLAEGFGEG FNGQLTIVAD       420
     ATNATENKAE AFADAVKEIK GLDHVASVTP AMPNKEGNFA IITVVPETGP NDVTTKDLVH       480
     DVRSLSDKNG VDLLVTGSTA VNIDISDRLN DAIPVFAVLI VGFAFVLLTI VFRSLLVPLV       540
     AVAGFMLTMT ATLGICVFVL QDGNLIDFFK IPEKGPILAF LPILSIGILF GLAMDYQVFL       600
     VSRMREEYVK TNNPVQAIQA GLKHSGPVVT AAGLIMIFVF AGFIFAGEAS IKANGLALSF       660
     GVLFDAFIVR MTLIPSVMKL MGNAAWYLPK WLDKIIPNVD IEGHQLTKEI QPEIDHEQKK       720
     QISV                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page