(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFL

AB001488.YDFL        Location/Qualifiers
FT   CDS             complement(127404..128216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfL"
FT                   /note="PROBABLE REGULATORY PROTEIN, SIMILAR TO
FT                   MULTIDRUG-EFFLUX TRANSPORTER REGULATORS IN B.SUBTILIS."
FT                   /db_xref="GOA:P96690"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96690"
FT                   /protein_id="BAA19380.1"
FT                   /translation="MKEFFSIGEVSKLFNVKISALRYYDEIGLLKPEYKDEQTNYRYYS
FT                   TQQFERLDTIKYLRALGLPINKLLDFYNSQNTNTLLHLLKSQQVEIDRKKKELERIERK
FT                   ISRRITHIEDAVNMPLHQISKIKLPAMRVAYLQHEYVLGHDIEHSLAELRTHLNVNEDI
FT                   FIGKIGLSISAANVKAKQFDKYSSIFMILEDENEKTSSEIIFPSREYLQIRFKGSHPEA
FT                   EPYYKKLLAYMKEHHYEVAGDSIEITLIDYGITNNLDNYVTEILLPIK"
     MKEFFSIGEV SKLFNVKISA LRYYDEIGLL KPEYKDEQTN YRYYSTQQFE RLDTIKYLRA        60
     LGLPINKLLD FYNSQNTNTL LHLLKSQQVE IDRKKKELER IERKISRRIT HIEDAVNMPL       120
     HQISKIKLPA MRVAYLQHEY VLGHDIEHSL AELRTHLNVN EDIFIGKIGL SISAANVKAK       180
     QFDKYSSIFM ILEDENEKTS SEIIFPSREY LQIRFKGSHP EAEPYYKKLL AYMKEHHYEV       240
     AGDSIEITLI DYGITNNLDN YVTEILLPIK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page