(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFO

AB001488.YDFO        Location/Qualifiers
FT   CDS             130332..131270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfO"
FT                   /note="SIMILAR TO PENTACHLOROPHENOL-INDUCED PERIPLASMIC
FT                   PROTEIN IN FLAVOBACTERIUM SP"
FT                   /db_xref="GOA:P96693"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="PDB:3OAJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96693"
FT                   /protein_id="BAA19383.1"
FT                   /translation="MAKKTMGIHHITAIVGHPQENTDFYAGVLGLRLVKQTVNFDDPGT
FT                   YHLYFGNEGGKPGTIITFFPWAGARQGVIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVP
FT                   YTKIERFGEQYVEFDDPHGLHLEIVEREEGEANTWTFGEVTPDVAIKGFGGATLLSEQP
FT                   DKTADLLENIMGLERVGKEGDFVRYRSAGDIGNVIDLKLTPIGRGQMGAGTVHHIAWRA
FT                   NDDEDQLDWQRYIASHGYGVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDETQET
FT                   MGEKLMLPVQYEPHRTQIEQGLLPFEVRELD"
     MAKKTMGIHH ITAIVGHPQE NTDFYAGVLG LRLVKQTVNF DDPGTYHLYF GNEGGKPGTI        60
     ITFFPWAGAR QGVIGDGQVG VTSYVVPKGA MAFWEKRLEK FNVPYTKIER FGEQYVEFDD       120
     PHGLHLEIVE REEGEANTWT FGEVTPDVAI KGFGGATLLS EQPDKTADLL ENIMGLERVG       180
     KEGDFVRYRS AGDIGNVIDL KLTPIGRGQM GAGTVHHIAW RANDDEDQLD WQRYIASHGY       240
     GVTPVRDRNY FNAIYFREHG EILFEIATDP PGFAHDETQE TMGEKLMLPV QYEPHRTQIE       300
     QGLLPFEVRE LD                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page