(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGF

AB001488.YDGF        Location/Qualifiers
FT   CDS             complement(139917..141293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /note="PROBABLE AMINO ACID TRANSPORT PERMIASE."
FT                   /db_xref="GOA:P96704"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96704"
FT                   /protein_id="BAA19395.1"
FT                   /translation="MTDDMTKDNINQQTLQRGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYMITGIICFLIMRSLGELLLSNLNYHSFVDFVQDYLGDMAAFITGWTYW
FT                   FCWISIAMADLTAVGLYTQYWLPGVPQWVPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIVIGLVMIFKGFSTSSGVSSFTNLWSHGGLFPNGMHGFILSFQMVVFAFVG
FT                   IELVGLTAGETENPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWDIINPSESPFVQV
FT                   FVAVGIVGAASIINFVVLTSAASACNSAVFSTSRMVYSLAKDHNAPESMAKLTQRKVPR
FT                   NALFFSAIVILIGVTLNYIMPEGVFTLITSISTVCFIYIWGITVICHMKYRKTRPELAK
FT                   TNKFKLPLYPFTNYLILAFLAFVLVVLALAQDTRVSLFVTPVWFILLIVIYKVRKAKHQ
FT                   "
     MTDDMTKDNI NQQTLQRGLK NRHIQLIAIG GAIGTGLFLG SGKSIHFAGP SILFAYMITG        60
     IICFLIMRSL GELLLSNLNY HSFVDFVQDY LGDMAAFITG WTYWFCWISI AMADLTAVGL       120
     YTQYWLPGVP QWVPGLIALI ILLIMNLATV KLFGELEFWF ALIKVIAILA LIVIGLVMIF       180
     KGFSTSSGVS SFTNLWSHGG LFPNGMHGFI LSFQMVVFAF VGIELVGLTA GETENPEKVI       240
     PKAINNIPVR VLLFYIGALL VIMSIYPWDI INPSESPFVQ VFVAVGIVGA ASIINFVVLT       300
     SAASACNSAV FSTSRMVYSL AKDHNAPESM AKLTQRKVPR NALFFSAIVI LIGVTLNYIM       360
     PEGVFTLITS ISTVCFIYIW GITVICHMKY RKTRPELAKT NKFKLPLYPF TNYLILAFLA       420
     FVLVVLALAQ DTRVSLFVTP VWFILLIVIY KVRKAKHQ                               458
//

If you have problems or comments...

PBIL Back to PBIL home page