(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGH

AB001488.YDGH        Location/Qualifiers
FT   CDS             142607..145264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR PRODUCT IN
FT                   MYCOBACTERIUM LEPRAE."
FT                   /db_xref="GOA:P96706"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96706"
FT                   /protein_id="BAA19398.1"
FT                   /translation="MRAIIKFKWAIAAIVLALTVVLSLFSPNLTELANQKGQAQLPADA
FT                   VSERANAILKQAGEDNNSISVVFTLDNAIKKETENQLRIIIDKIKKIDGVEEVTSPLSA
FT                   EKEVKDQLMSKDKKTVLMPVTITGSDKKAEKIADEIYQIVPDDLTAYITGASLINQDFA
FT                   HSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGILVYNVDF
FT                   PISTFTQTFLVAILFGIGTDYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGF
FT                   AVLIGFSALGFAKFAIFQSAVGVAVGVGILMIILYTLLPLFMVTLGEKLFWPSKKVLSH
FT                   SDNKLWAFLGRHSVARPFLFIVITVVITLPFILTYDDQISFDSTAEISSDYKSIKALEA
FT                   IKDGFGEGKAFPINVVVKGDKDLTTADTIPYLGNISKAIEKVDHVDSVMTITQPTGKKI
FT                   KDLYIDNQLGSVSDGLDKTVKGIADVQSGLTDIENGLNQMAGQTGSASNGGSGGSLGDA
FT                   ADGLGKINQQLQLVSKQISQTGNTAQTVQQLTAISGQLGQIQTGLEQANQQLSGQQAQA
FT                   GTLTESLKKLSEGVKSANEGLTKVSDGITASSDILEDMSKSPTVRDTGIFIPDQVMKDK
FT                   DFKKSIDQYSFADGKGVQLSVVLDSNPYSEQAITTINQIKKAVANEVDGTPLENAQIVY
FT                   GGVTSMNADLKELSTTDFSRTMVIMIIGLFIVLTILFRSMIMPIYMIASLLLTYYTSIS
FT                   ITELIFVNGLGNAGVSWAVPFFSFVILIALGVDYSIFLLDRFKEEVHLGIEQGVVRSMS
FT                   KMGSVIITAAIILAGTFAAMMPSGVNTLMQVASVIIIGLLLYGLVILPLFIPAIIATFG
FT                   EGNWWPFGRKKGKE"
     MRAIIKFKWA IAAIVLALTV VLSLFSPNLT ELANQKGQAQ LPADAVSERA NAILKQAGED        60
     NNSISVVFTL DNAIKKETEN QLRIIIDKIK KIDGVEEVTS PLSAEKEVKD QLMSKDKKTV       120
     LMPVTITGSD KKAEKIADEI YQIVPDDLTA YITGASLINQ DFAHSSEEGL KKTEVITVCL       180
     IIGLLLIVFR SVVTPFIPIV VVGFSYLISQ SILGILVYNV DFPISTFTQT FLVAILFGIG       240
     TDYCILLLTR FREELANGHD KKEAALIAYR TGGKTLFISG FAVLIGFSAL GFAKFAIFQS       300
     AVGVAVGVGI LMIILYTLLP LFMVTLGEKL FWPSKKVLSH SDNKLWAFLG RHSVARPFLF       360
     IVITVVITLP FILTYDDQIS FDSTAEISSD YKSIKALEAI KDGFGEGKAF PINVVVKGDK       420
     DLTTADTIPY LGNISKAIEK VDHVDSVMTI TQPTGKKIKD LYIDNQLGSV SDGLDKTVKG       480
     IADVQSGLTD IENGLNQMAG QTGSASNGGS GGSLGDAADG LGKINQQLQL VSKQISQTGN       540
     TAQTVQQLTA ISGQLGQIQT GLEQANQQLS GQQAQAGTLT ESLKKLSEGV KSANEGLTKV       600
     SDGITASSDI LEDMSKSPTV RDTGIFIPDQ VMKDKDFKKS IDQYSFADGK GVQLSVVLDS       660
     NPYSEQAITT INQIKKAVAN EVDGTPLENA QIVYGGVTSM NADLKELSTT DFSRTMVIMI       720
     IGLFIVLTIL FRSMIMPIYM IASLLLTYYT SISITELIFV NGLGNAGVSW AVPFFSFVIL       780
     IALGVDYSIF LLDRFKEEVH LGIEQGVVRS MSKMGSVIIT AAIILAGTFA AMMPSGVNTL       840
     MQVASVIIIG LLLYGLVILP LFIPAIIATF GEGNWWPFGR KKGKE                       885
//

If you have problems or comments...

PBIL Back to PBIL home page