(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGK

AB001488.YDGK        Location/Qualifiers
FT   CDS             146860..148068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK"
FT                   /note="SIMILAR TO BICYCLOMYCIN RESISTANCE PROTEIN."
FT                   /db_xref="GOA:P96709"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96709"
FT                   /protein_id="BAA19401.1"
FT                   /translation="MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIAKDLSAS
FT                   ASLVQLSLTACLVGLTIGQLIVGPVSDAQGRRKPLLICIFLFALSSLFCALSPNITTLV
FT                   AARFLQGFTASAGLVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFHVLMIIGFLLVLLIALRLKETLPLEKRIPSSIGTSVKTMGSLLKDRSFMGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSILFGINGLAIISGSFIIGRFGGIIH
FT                   EKSLLRIAVITAMIATAVLLTMTMIHGPLATLVISIFIYMITIGMVLTSTFTLAMEKQG
FT                   HRAGSASALLGMLPLLLGSIVSPLVGINETTAVPMGAIMFVTAVIGSLAFFGLTKERVG
FT                   QNS"
     MLHNPTGKER LALAFLLGML AILGPLNIDM YLPSFPEIAK DLSASASLVQ LSLTACLVGL        60
     TIGQLIVGPV SDAQGRRKPL LICIFLFALS SLFCALSPNI TTLVAARFLQ GFTASAGLVL       120
     SRAIVRDVFT GRELSKFFSL LMVITAVAPM VAPMTGGAIL LLPFATWHTI FHVLMIIGFL       180
     LVLLIALRLK ETLPLEKRIP SSIGTSVKTM GSLLKDRSFM GYALTVGFIH GGSFAYVSGT       240
     PFVYQDIYGV SPQVFSILFG INGLAIISGS FIIGRFGGII HEKSLLRIAV ITAMIATAVL       300
     LTMTMIHGPL ATLVISIFIY MITIGMVLTS TFTLAMEKQG HRAGSASALL GMLPLLLGSI       360
     VSPLVGINET TAVPMGAIMF VTAVIGSLAF FGLTKERVGQ NS                          402
//

If you have problems or comments...

PBIL Back to PBIL home page