(data stored in ACNUC7820 zone)

EMBL: AB065604.PE1

AB065604.PE1         Location/Qualifiers
FT   CDS             join(201..1088,2478..2669)
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NH09"
FT                   /db_xref="H-InvDB:HIT000383271.8"
FT                   /db_xref="HGNC:HGNC:19628"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NH09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05832.1"
FT                   /translation="MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLML
FT                   LLVIRADSCLHKPMYFFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFV
FT                   FVTAGTEACLLSGMAYDRHAAIRRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLA
FT                   VNMVFCEAKIIHHYSYEMPSLLPLSCSDISRSLIVLLCSTLLHGLGNFLLVFLSYTRII
FT                   STILSISSTSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTP
FT                   MLNSLIYSLKNKEVKGERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTP
FT                   QPQGACACSALRAAPTALP"
     MALGNHSTIT EFLLLGLSAD PNIRALLFVL FLGIYLLTIM ENLMLLLVIR ADSCLHKPMY        60
     FFLSHLSFVD LCFSSVIVPK MLENLLSQRK TISVEGCLAQ VFFVFVTAGT EACLLSGMAY       120
     DRHAAIRRPL LYGQIMGKQL YMHLVWGSWG LGFLDALINV LLAVNMVFCE AKIIHHYSYE       180
     MPSLLPLSCS DISRSLIVLL CSTLLHGLGN FLLVFLSYTR IISTILSISS TSGRSKAFST       240
     CSAHLTAVTL YYGSGLLRHL MPNSGSPIEL IFSVQYTVVT PMLNSLIYSL KNKEVKGERS       300
     LRDSSHLPQL HKGQARWKRP AFTEGRREPG HPELSIPVTP QPQGACACSA LRAAPTALP        359
//

If you have problems or comments...

PBIL Back to PBIL home page