(data stored in ACNUC7820 zone)

EMBL: AB065878.PE1

AB065878.PE1         Location/Qualifiers
FT   CDS             201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGD7"
FT                   /db_xref="H-InvDB:HIT000383484.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NGD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC06096.1"
FT                   /translation="MYLVTVLRNLLSILAVSSDSHLHTPMYFFLSNLCWADIGYTSATV
FT                   PKMIVDTQSHGRVISHAGCLTQMSFLVLFACIEDMLLTVMAYDCFVAICCPLHYPVIVN
FT                   PHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFIYFDSTMFGFLPISGILLSYSKIVPSVLRMSSSDGKYKAFSTCGSHLAVVC"
     MYLVTVLRNL LSILAVSSDS HLHTPMYFFL SNLCWADIGY TSATVPKMIV DTQSHGRVIS        60
     HAGCLTQMSF LVLFACIEDM LLTVMAYDCF VAICCPLHYP VIVNPHLCVF FVLVSFFLSL       120
     LDSQLHSWIV LQFTIIKNVE ISNFVCDPSQ LLKLACSDSV INSIFIYFDS TMFGFLPISG       180
     ILLSYSKIVP SVLRMSSSDG KYKAFSTCGS HLAVVC                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page