(data stored in ACNUC13479 zone)

EMBL: AC005724.PE10

AC005724.PE10        Location/Qualifiers
FT   CDS             complement(join(34793..35362,35448..35666,35752..35979,
FT                   36063..36165,36242..36410,36509..36617))
FT                   /codon_start=1
FT                   /gene="At2g18720"
FT                   /product="putative translation initiation factor eIF-2B
FT                   gamma subunit"
FT                   /db_xref="GOA:Q9ZV47"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV47"
FT                   /protein_id="AAD08941.1"
FT                   /translation="MSKNKGLAEQDLSKLDVAQLHPLSPEVISRQATINIGTIGHVAHG
FT                   KSTIVKAVSGVHTVKFKSELERNITIKLGYANAKIYKCEKCPRPVAYKSFGSGKEDNPS
FT                   CDVSGHEKYKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLIIAANETCPQPQTAE
FT                   HLASVDMMHLKDIIIIQNKIDLIQENEAIKQHEDIQRFITNTNAEGAPIVPVSAQLKYN
FT                   IDVLCEYIVKKIPLPVRDFVSPPRMIVIRSFDVNKPGSDYDGMKGGVAGGSILQGVLKV
FT                   GHIIEIRPGITRKDENGDTKCTPIYTRITSLYAEQNELQFAVPGGLIGIGTSMDPTLTR
FT                   GDRLVGQVLGEIGTLPDVYVELEVSFQLLTRLIGVKTKETERQMRVSKLVKGEILMLNI
FT                   GSMSTGAMVIGVKKDMVKVNLTLPVCTSIGEKVAISRRVDRHWRLIGRGQIEAGTTIFI
FT                   PSPPSLA"
     MSKNKGLAEQ DLSKLDVAQL HPLSPEVISR QATINIGTIG HVAHGKSTIV KAVSGVHTVK        60
     FKSELERNIT IKLGYANAKI YKCEKCPRPV AYKSFGSGKE DNPSCDVSGH EKYKMKLLRH       120
     VSFVDCPGHD ILMATMLNGA AIMDGALLII AANETCPQPQ TAEHLASVDM MHLKDIIIIQ       180
     NKIDLIQENE AIKQHEDIQR FITNTNAEGA PIVPVSAQLK YNIDVLCEYI VKKIPLPVRD       240
     FVSPPRMIVI RSFDVNKPGS DYDGMKGGVA GGSILQGVLK VGHIIEIRPG ITRKDENGDT       300
     KCTPIYTRIT SLYAEQNELQ FAVPGGLIGI GTSMDPTLTR GDRLVGQVLG EIGTLPDVYV       360
     ELEVSFQLLT RLIGVKTKET ERQMRVSKLV KGEILMLNIG SMSTGAMVIG VKKDMVKVNL       420
     TLPVCTSIGE KVAISRRVDR HWRLIGRGQI EAGTTIFIPS PPSLA                       465
//

If you have problems or comments...

PBIL Back to PBIL home page