(data stored in ACNUC13479 zone)

EMBL: AC005724.PE11

AC005724.PE11        Location/Qualifiers
FT   CDS             join(38849..39292,39743..39880,39964..40049,40140..40227,
FT                   40334..40409,40497..40579,40700..40770,40876..40953,
FT                   41041..41128,41209..41325,41404..41562)
FT                   /codon_start=1
FT                   /gene="At2g18730"
FT                   /product="putative diacylglycerol kinase"
FT                   /db_xref="GOA:Q8VZG1"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR016961"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR037607"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZG1"
FT                   /protein_id="AAD08942.1"
FT                   /translation="MDSPVSKTDASKEKFVASRPSTADSKTMRGCGLANLAWVGVDKVE
FT                   LRQRLMMPEYLRLAMRDCIKRKDSSAIPDHLLLPGGAVADMAPHAPMVVFINPNSGGRH
FT                   GPVLKERLQQLMSEEQVLLSLNLYFKSFSLGFWGNFESNLYLLCVAGGDGTVGWVLGCL
FT                   GELNKDGKSQIPPVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLHRASMGPVARLD
FT                   SWKILVSMPSGEVVDPPYSLKPAEENELDQGLDAGIDAPPLAKAYEGVFYNYLSIGMDA
FT                   QVAYGFHHLRNTKPYLAQGPISNKIIYSSFGCSQGWFCTPCVNDPGLRGLRNIMKIHIK
FT                   KVNCSQWEEIAVPKNVRSIVALNLHSYGSGSHPWGNLKPDYLEKRGFVEAHCDDGLIEI
FT                   FGFKQGWHASFVMAELISAKHIAQAAAVRFELRGGDWRDAFLQMDGEPWKQPMSTEYST
FT                   FVEIKKVPYQSLMINNE"
     MDSPVSKTDA SKEKFVASRP STADSKTMRG CGLANLAWVG VDKVELRQRL MMPEYLRLAM        60
     RDCIKRKDSS AIPDHLLLPG GAVADMAPHA PMVVFINPNS GGRHGPVLKE RLQQLMSEEQ       120
     VLLSLNLYFK SFSLGFWGNF ESNLYLLCVA GGDGTVGWVL GCLGELNKDG KSQIPPVGVI       180
     PLGTGNDLSR SFGWGGSFPF AWRSAVKRTL HRASMGPVAR LDSWKILVSM PSGEVVDPPY       240
     SLKPAEENEL DQGLDAGIDA PPLAKAYEGV FYNYLSIGMD AQVAYGFHHL RNTKPYLAQG       300
     PISNKIIYSS FGCSQGWFCT PCVNDPGLRG LRNIMKIHIK KVNCSQWEEI AVPKNVRSIV       360
     ALNLHSYGSG SHPWGNLKPD YLEKRGFVEA HCDDGLIEIF GFKQGWHASF VMAELISAKH       420
     IAQAAAVRFE LRGGDWRDAF LQMDGEPWKQ PMSTEYSTFV EIKKVPYQSL MINNE            475
//

If you have problems or comments...

PBIL Back to PBIL home page