(data stored in ACNUC13479 zone)

EMBL: AC005724.PE13

AC005724.PE13        Location/Qualifiers
FT   CDS             join(45700..45815,45966..46041,46132..46190,46271..46764,
FT                   46850..47166)
FT                   /codon_start=1
FT                   /gene="At2g18750"
FT                   /product="putative calmodulin-binding protein"
FT                   /db_xref="GOA:C0SV51"
FT                   /db_xref="InterPro:IPR012416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SV51"
FT                   /protein_id="AAD08944.2"
FT                   /translation="MQTRYMERTNSMREKRKLEEDDNQQQQQQPERKRPALASVIVEAL
FT                   KMDSLQRLCSSLEPILRRVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRS
FT                   RLSVPLFTGGKIEGEQGAAIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDDG
FT                   WSGEEFEGHLVKERQGKRPLLTGDVQVTLKEGVGTLGELIFTDNSSWIRCRKFRLGLRV
FT                   SSGYCEGMRVREAKTEAFTVKDHRGELYKKHYPPALDDEVWRLEKIGKDGAFHKKLNKA
FT                   GIYNVKEFLRLMVKDSQKLRTVSARFNYPVSYQDVQILLFIMMTLTLIFRFLEVACQTG
FT                   CGRHLQSIPRHVY"
     MQTRYMERTN SMREKRKLEE DDNQQQQQQP ERKRPALASV IVEALKMDSL QRLCSSLEPI        60
     LRRVVSEEVE RALAKLGPAR LSERSSPKRI EGIGGRNLQL QFRSRLSVPL FTGGKIEGEQ       120
     GAAIHVVLLD MTTGHVLTVG PEASAKLDVV VLDGDFNTED DDGWSGEEFE GHLVKERQGK       180
     RPLLTGDVQV TLKEGVGTLG ELIFTDNSSW IRCRKFRLGL RVSSGYCEGM RVREAKTEAF       240
     TVKDHRGELY KKHYPPALDD EVWRLEKIGK DGAFHKKLNK AGIYNVKEFL RLMVKDSQKL       300
     RTVSARFNYP VSYQDVQILL FIMMTLTLIF RFLEVACQTG CGRHLQSIPR HVY              353
//

If you have problems or comments...

PBIL Back to PBIL home page