(data stored in ACNUC13479 zone)

EMBL: AC005724.PE14

AC005724.PE14        Location/Qualifiers
FT   CDS             join(49027..49116,49228..49749,49880..50282,50562..51429,
FT                   51511..52120,52210..52647,52743..53375)
FT                   /codon_start=1
FT                   /gene="At2g18760"
FT                   /product="putative SNF2/RAD54 family DNA repair and
FT                   recombination protein"
FT                   /db_xref="GOA:Q9ZV43"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV43"
FT                   /protein_id="AAD08945.1"
FT                   /translation="MEEDEDQFLLSSLGVTSANPEDLEQKILDEATKKPDNDEGGSVEE
FT                   KSTQLEGTNLLSSSQNELLNKLRAVKFEIDAVASTVENVDEIAAEKGLKKDDESDLQGL
FT                   HSGSALQHALATDRLRSLKKRKIQLEKELTGLHGQSASSSADHGNLLRDLVKEKPSLKR
FT                   KLKEIRKPSRRDGKKVKVVSFREDTDFDAVFDGASAGFVETERDELVRKGILTPFHKLD
FT                   GFERRLQQPGPSNSRNLPEGDDENEDSSIIDRAVQSMSLAAKARPTTKLLDAEDLPKLE
FT                   PPTAPFRRLRKLYKTPNSPDNEAKKRKAGKKSKKTRPLPEKKWRKRISREDSSLQGSGD
FT                   GRRILTTSSCEEEELDDFDDADDNERSSVQLEGGLNIPECIFRKLFDYQRVGVQWLWEL
FT                   HCQRAGGIIGDEMGLGKTIQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQKWYPD
FT                   FHVEILHDSAQDSGHGKGQGKASESDYDSESSVDSDHEPKSKNTKKWDSLLNRVLNSES
FT                   GLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMTGAP
FT                   IQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLRD
FT                   LIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQIFDGNRNSLY
FT                   GIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQ
FT                   QMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSEDMFVFVLTTKVGGLGTNLT
FT                   GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLT
FT                   NKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQSDKKPE
FT                   SDTQLALHKTAEGSSEQTDVEMTDKTGEAMDEETNILKSLFDAHGIHSAVNHDAIMNAN
FT                   DEEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRFGS
FT                   TVNSRLTQTGDKPSAIKNGISAGLSSGKAPSSAELLNRIRGSREQAIGVGLEQPQSSFP
FT                   SSSGSSSRVGSLQPEVLIRKICSFVQQKGGSADTTSIVNHFRDIVSFNDKQLFKNLLKE
FT                   IATLEKDQNRSFWVLKSEYKD"
     MEEDEDQFLL SSLGVTSANP EDLEQKILDE ATKKPDNDEG GSVEEKSTQL EGTNLLSSSQ        60
     NELLNKLRAV KFEIDAVAST VENVDEIAAE KGLKKDDESD LQGLHSGSAL QHALATDRLR       120
     SLKKRKIQLE KELTGLHGQS ASSSADHGNL LRDLVKEKPS LKRKLKEIRK PSRRDGKKVK       180
     VVSFREDTDF DAVFDGASAG FVETERDELV RKGILTPFHK LDGFERRLQQ PGPSNSRNLP       240
     EGDDENEDSS IIDRAVQSMS LAAKARPTTK LLDAEDLPKL EPPTAPFRRL RKLYKTPNSP       300
     DNEAKKRKAG KKSKKTRPLP EKKWRKRISR EDSSLQGSGD GRRILTTSSC EEEELDDFDD       360
     ADDNERSSVQ LEGGLNIPEC IFRKLFDYQR VGVQWLWELH CQRAGGIIGD EMGLGKTIQV       420
     LSFLGSLHFS KMYKPSIIIC PVTLLRQWRR EAQKWYPDFH VEILHDSAQD SGHGKGQGKA       480
     SESDYDSESS VDSDHEPKSK NTKKWDSLLN RVLNSESGLL ITTYEQLRLQ GEKLLNIEWG       540
     YAVLDEGHRI RNPNSDITLV CKQLQTVHRI IMTGAPIQNK LTELWSLFDF VFPGKLGVLP       600
     VFEAEFSVPI TVGGYANASP LQVSTAYRCA VVLRDLIMPY LLRRMKADVN AHLTKKTEHV       660
     LFCSLTVEQR STYRAFLASS EVEQIFDGNR NSLYGIDVMR KICNHPDLLE REHSHQNPDY       720
     GNPERSGKMK VVAEVLKVWK QQGHRVLLFS QTQQMLDILE SFLVANEYSY RRMDGLTPVK       780
     QRMALIDEFN NSEDMFVFVL TTKVGGLGTN LTGANRVIIF DPDWNPSNDM QARERAWRIG       840
     QKKDVTVYRL ITRGTIEEKV YHRQIYKHFL TNKILKNPQQ RRFFKARDMK DLFILKDDGD       900
     SNASTETSNI FSQLAEEINI VGVQSDKKPE SDTQLALHKT AEGSSEQTDV EMTDKTGEAM       960
     DEETNILKSL FDAHGIHSAV NHDAIMNAND EEEKMRLEHQ ASQVAQRAAE ALRQSRMLRS      1020
     RESISVPTWT GRSGCAGAPS SVRRRFGSTV NSRLTQTGDK PSAIKNGISA GLSSGKAPSS      1080
     AELLNRIRGS REQAIGVGLE QPQSSFPSSS GSSSRVGSLQ PEVLIRKICS FVQQKGGSAD      1140
     TTSIVNHFRD IVSFNDKQLF KNLLKEIATL EKDQNRSFWV LKSEYKD                    1187
//

If you have problems or comments...

PBIL Back to PBIL home page