(data stored in ACNUC13479 zone)

EMBL: AC005724.PE15

AC005724.PE15        Location/Qualifiers
FT   CDS             join(54857..54995,55165..55247,55403..55492,55577..55725,
FT                   55817..55948,56044..56233)
FT                   /codon_start=1
FT                   /gene="At2g18770"
FT                   /product="putative signal recognition particle receptor
FT                   beta subunit"
FT                   /db_xref="GOA:Q9ZV42"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV42"
FT                   /protein_id="AAD08946.1"
FT                   /translation="MDNLEDLKIVAEQWSKQGLEFVQKIPPPQLYTAIGVLLLATIWLL
FT                   SIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTK
FT                   KGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNA
FT                   SVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIE
FT                   GEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVKP"
     MDNLEDLKIV AEQWSKQGLE FVQKIPPPQL YTAIGVLLLA TIWLLSIRLF RRTKSNTVLL        60
     SGLSGSGKTV LFYQLRDGSS HQGAVTSMEP NEGTFVLHNE NNTKKGKVKP VHLIDVPGHS       120
     RLISKLEEYL PRAAAVVFVV DALEFLPNIR AASEYLYDIL TNASVIKNKT PVLLCCNKTD       180
     KVTAHTKEFI RKQMEKEIDK LRVSRSAIST ADIANDFTLG IEGEVFSFSH CHNKVTVAEA       240
     SGLTGETDQV QEFIREHVKP                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page