(data stored in ACNUC13479 zone)

EMBL: AC005724.PE16

AC005724.PE16        Location/Qualifiers
FT   CDS             complement(56856..57947)
FT                   /codon_start=1
FT                   /gene="At2g18780"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q84V15"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006527"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR017451"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84V15"
FT                   /protein_id="AAD08947.1"
FT                   /translation="MLSDLPKDVAEEVLSKFPVTSLRRVRFTCKKLNTLSKDMSFTRKH
FT                   IDKEEAKKKQSKEFHVVMMLDFRVSLFSLNLLNPNPIERLGQLVSLDGGAQVDISNIFH
FT                   CEGFLLCTTKDISRVVVWNPCVGQTIWIKPRNSFNKWDRYALGYDVMKNHKVLRFVDDG
FT                   EYGRRHLLCEFEIYSFESDSWEVLDVNPDWEIDFVHRGLSIDGNSYWFARDKVVPYGGQ
FT                   DPSYFLLCFDFTTERFRPPLPLPFQPYFGDTVALSSVGDNQIAVLCQRSSSPYTLKIWI
FT                   SSKVEPNAVSWNKLFLKVDMKPLTGNSFSYSGGSFFVDEEKKMAVVLDKNIGGGFDPTR
FT                   NIAYIIGKEGYFKKVDLGESRHL"
     MLSDLPKDVA EEVLSKFPVT SLRRVRFTCK KLNTLSKDMS FTRKHIDKEE AKKKQSKEFH        60
     VVMMLDFRVS LFSLNLLNPN PIERLGQLVS LDGGAQVDIS NIFHCEGFLL CTTKDISRVV       120
     VWNPCVGQTI WIKPRNSFNK WDRYALGYDV MKNHKVLRFV DDGEYGRRHL LCEFEIYSFE       180
     SDSWEVLDVN PDWEIDFVHR GLSIDGNSYW FARDKVVPYG GQDPSYFLLC FDFTTERFRP       240
     PLPLPFQPYF GDTVALSSVG DNQIAVLCQR SSSPYTLKIW ISSKVEPNAV SWNKLFLKVD       300
     MKPLTGNSFS YSGGSFFVDE EKKMAVVLDK NIGGGFDPTR NIAYIIGKEG YFKKVDLGES       360
     RHL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page