(data stored in ACNUC13479 zone)

EMBL: AC005724.PE19

AC005724.PE19        Location/Qualifiers
FT   CDS             complement(join(67812..68249,69076..69342))
FT                   /codon_start=1
FT                   /gene="At2g18810"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9ZV39"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR005508"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV39"
FT                   /protein_id="AAD08950.1"
FT                   /translation="MVRAFAYEEIGETSTEAHASVEDNKRDRTRRVINYNLRSTTMISS
FT                   LSKRLKIDECKNQDPEQNPNRVASSPSLCHVKSKRPQKGVSNKPILDMDFLNEEELEKI
FT                   DRHYKKISDSDKGADVILVNSEGLQRKLKLKRWDMTSTSNYVLGSGWNKVVTENILETG
FT                   TRLRLWSFHSPDMLFFALVLSDPDLAPTKDWECLNLLAKLTVETACLEASQDADTMSSL
FT                   VSDTELDLELRL"
     MVRAFAYEEI GETSTEAHAS VEDNKRDRTR RVINYNLRST TMISSLSKRL KIDECKNQDP        60
     EQNPNRVASS PSLCHVKSKR PQKGVSNKPI LDMDFLNEEE LEKIDRHYKK ISDSDKGADV       120
     ILVNSEGLQR KLKLKRWDMT STSNYVLGSG WNKVVTENIL ETGTRLRLWS FHSPDMLFFA       180
     LVLSDPDLAP TKDWECLNLL AKLTVETACL EASQDADTMS SLVSDTELDL ELRL             234
//

If you have problems or comments...

PBIL Back to PBIL home page