(data stored in ACNUC13479 zone)

EMBL: AC005724.PE22

AC005724.PE22        Location/Qualifiers
FT   CDS             join(78161..78670,79297..79371,79461..79721)
FT                   /codon_start=1
FT                   /gene="At2g18840"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:O64614"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:O64614"
FT                   /protein_id="AAD08953.1"
FT                   /translation="MSQGDTVPLHPSSQSDIDEIENLINESVQSGPGTVLAARPPSPTR
FT                   PSIPVSSSSSSSPFMQSNLPPLHPSSSAQKVTHVPVPPPLPAVSNSSNFQGASAFGSPP
FT                   NTLTEPVWDTVKRDLSRIVSNLKLVVFPNPYREDPGKALRDWDLWGPFFFIVFLGLTLS
FT                   WSASVKKSEVFAVAFALLAAGAVILTLNVLLLGGHIIFFQSLSLLGYCLFPLDVGAVIC
FT                   MLKDNVILKMVVVSVTLAWSSWAAYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN
FT                   "
     MSQGDTVPLH PSSQSDIDEI ENLINESVQS GPGTVLAARP PSPTRPSIPV SSSSSSSPFM        60
     QSNLPPLHPS SSAQKVTHVP VPPPLPAVSN SSNFQGASAF GSPPNTLTEP VWDTVKRDLS       120
     RIVSNLKLVV FPNPYREDPG KALRDWDLWG PFFFIVFLGL TLSWSASVKK SEVFAVAFAL       180
     LAAGAVILTL NVLLLGGHII FFQSLSLLGY CLFPLDVGAV ICMLKDNVIL KMVVVSVTLA       240
     WSSWAAYPFM SSAVNPRRKA LALYPVFLMY VSVGFLIIAI N                           281
//

If you have problems or comments...

PBIL Back to PBIL home page