(data stored in ACNUC13479 zone)

EMBL: AC005724.PE23

AC005724.PE23        Location/Qualifiers
FT   CDS             join(80798..80863,81054..81182,81252..81543,81626..81744,
FT                   81831..81963,82050..82126,82214..82313,82763..82935,
FT                   83028..83128,83217..83352)
FT                   /codon_start=1
FT                   /gene="At2g18850"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:O64615"
FT                   /protein_id="AAD08954.1"
FT                   /translation="MSETGDLCVELPKDDPFYHHKKKFLSCKGLCVKETLNLSGSLSQQ
FT                   LLNAALEKLLHFGRIVNLDKVEVYFGEDACTPAGIYSVRNEISALSWILSLIPVSCKMQ
FT                   TQVDTFEALRAALKGRINEVVGAEKEKARVVDSYRCEKESKLVEWGQDNGVKTKLQIAQ
FT                   IDGYGRGAIASEDLKFGDVALEIPVSSIISEEYVYNSDMYPILETFDGITSETMLLLWT
FT                   MREKHNLDSKFKPYFDSLQENFCTGLSFGVDAIMELDGTLLLDEIMQAKELLRERYDEL
FT                   IPLLSNHREVFPPELYTWEHYLWAYFDVIDDEDIETEFSWTTHMLRGTWLSSNHNIFHY
FT                   GLPTPLLNYLRKAHGLVHHSETDLWKNLEVEIGVLENLQSTFDDMMQNLGDADSIDREN
FT                   ADWDVKLAMEFKERQRKIVSSILDSCSAGIKLVQESITNPPV"
     MSETGDLCVE LPKDDPFYHH KKKFLSCKGL CVKETLNLSG SLSQQLLNAA LEKLLHFGRI        60
     VNLDKVEVYF GEDACTPAGI YSVRNEISAL SWILSLIPVS CKMQTQVDTF EALRAALKGR       120
     INEVVGAEKE KARVVDSYRC EKESKLVEWG QDNGVKTKLQ IAQIDGYGRG AIASEDLKFG       180
     DVALEIPVSS IISEEYVYNS DMYPILETFD GITSETMLLL WTMREKHNLD SKFKPYFDSL       240
     QENFCTGLSF GVDAIMELDG TLLLDEIMQA KELLRERYDE LIPLLSNHRE VFPPELYTWE       300
     HYLWAYFDVI DDEDIETEFS WTTHMLRGTW LSSNHNIFHY GLPTPLLNYL RKAHGLVHHS       360
     ETDLWKNLEV EIGVLENLQS TFDDMMQNLG DADSIDRENA DWDVKLAMEF KERQRKIVSS       420
     ILDSCSAGIK LVQESITNPP V                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page