(data stored in ACNUC13479 zone)

EMBL: AC005724.PE24

AC005724.PE24        Location/Qualifiers
FT   CDS             join(84231..84313,84434..84524,84615..85232)
FT                   /codon_start=1
FT                   /gene="At2g18860"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:O64616"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniProtKB/TrEMBL:O64616"
FT                   /protein_id="AAD08955.1"
FT                   /translation="MMVVNSFDLWQKDVFFSAAEEVQKSTDIMESAYRLWIREKKDEIC
FT                   KELQAALGTAKWQLEEFEKAVRLSHKRCGDNDSSSTRHKQFVTAIENQIHRVETSLQEA
FT                   YSENGKKPLRWVDLNEEERDDLAMFLSGSSRTSQSFSGESSIKSRESTNSSLVENVMEV
FT                   SAKVTFKKAKVYGDGSECVIDIEERVTPGQAEKSVGLRRIWSSPNFNSLRIIVPGGDNE
FT                   EEKETLVAQIEATPKVKGTKSVLWMQRLPDHNQVSVLIYKL"
     MMVVNSFDLW QKDVFFSAAE EVQKSTDIME SAYRLWIREK KDEICKELQA ALGTAKWQLE        60
     EFEKAVRLSH KRCGDNDSSS TRHKQFVTAI ENQIHRVETS LQEAYSENGK KPLRWVDLNE       120
     EERDDLAMFL SGSSRTSQSF SGESSIKSRE STNSSLVENV MEVSAKVTFK KAKVYGDGSE       180
     CVIDIEERVT PGQAEKSVGL RRIWSSPNFN SLRIIVPGGD NEEEKETLVA QIEATPKVKG       240
     TKSVLWMQRL PDHNQVSVLI YKL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page