(data stored in ACNUC13479 zone)

EMBL: AC005724.PE3

AC005724.PE3         Location/Qualifiers
FT   CDS             complement(6733..8004)
FT                   /codon_start=1
FT                   /gene="At2g18650"
FT                   /product="putative RING zinc finger protein"
FT                   /db_xref="GOA:Q9ZV53"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV53"
FT                   /protein_id="AAD08934.1"
FT                   /translation="MNKILPEMKSTQNLISSSPPPPLIPLKSNTSLSNLNSKITPNILL
FT                   IIIILSIIFFISGLLHILVKFLLTPSRESREDYFDNVTALQGQLQQLFNLHDSGVDQSL
FT                   IDTLPVFHYKSIVGLKISPFDCPVCLCEFETEDKLRLLPKCSHAFHVECIDTWLLSHST
FT                   CPLCRSNLLSGFSSHHNLSSSYLLVLESEQSSRDMVPVLESNSQLGYDVNNDSESTRIR
FT                   SGRKSCDPDGDMDGLDEKVVPLEVKLGKFRNIDHVGEGSDQKKNSISGNSKNVDGRRCL
FT                   SMGSYEYIMDQEATLKVHVSTKKLSGKDRVPSHRTVMSECGFDPTVKGIEKSVVERESF
FT                   SLSKIWLRGKKEKQKGTSARDSDCSFVSSSSLRFPNHRIPPEESLKSENSESLETKTPS
FT                   FARRTMHWLAGRQNKIVQPSTSNV"
     MNKILPEMKS TQNLISSSPP PPLIPLKSNT SLSNLNSKIT PNILLIIIIL SIIFFISGLL        60
     HILVKFLLTP SRESREDYFD NVTALQGQLQ QLFNLHDSGV DQSLIDTLPV FHYKSIVGLK       120
     ISPFDCPVCL CEFETEDKLR LLPKCSHAFH VECIDTWLLS HSTCPLCRSN LLSGFSSHHN       180
     LSSSYLLVLE SEQSSRDMVP VLESNSQLGY DVNNDSESTR IRSGRKSCDP DGDMDGLDEK       240
     VVPLEVKLGK FRNIDHVGEG SDQKKNSISG NSKNVDGRRC LSMGSYEYIM DQEATLKVHV       300
     STKKLSGKDR VPSHRTVMSE CGFDPTVKGI EKSVVERESF SLSKIWLRGK KEKQKGTSAR       360
     DSDCSFVSSS SLRFPNHRIP PEESLKSENS ESLETKTPSF ARRTMHWLAG RQNKIVQPST       420
     SNV                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page