(data stored in ACNUC13479 zone)

EMBL: AC005724.PE4

AC005724.PE4         Location/Qualifiers
FT   CDS             complement(join(11029..11303,11403..11508))
FT                   /codon_start=1
FT                   /gene="At2g18660"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9ZV52"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV52"
FT                   /protein_id="AAD08935.1"
FT                   /translation="MAVKFVVVMIVFAQILAPIAEAAQGKAVYYDPPYTRSACYGTQRE
FT                   TLVVGVKNNLWQNGRACGRRYRVRCIGATYNFDRACTGRTVDVKVVDFCREPCNGDLNL
FT                   SRDAFRVIANTDAGNIRVVYTP"
     MAVKFVVVMI VFAQILAPIA EAAQGKAVYY DPPYTRSACY GTQRETLVVG VKNNLWQNGR        60
     ACGRRYRVRC IGATYNFDRA CTGRTVDVKV VDFCREPCNG DLNLSRDAFR VIANTDAGNI       120
     RVVYTP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page