(data stored in ACNUC13479 zone)

EMBL: AC005724.PE5

AC005724.PE5         Location/Qualifiers
FT   CDS             join(13342..13883,14322..14325)
FT                   /codon_start=1
FT                   /gene="At2g18670"
FT                   /product="putative RING zinc finger protein"
FT                   /db_xref="GOA:Q9ZV51"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV51"
FT                   /protein_id="AAD08936.1"
FT                   /translation="MPPTNNYRISGEPPSTTPSHPPPKPKTRILSLFLVGVIMFSIFFL
FT                   FLVLIGIASVLILPLLLSSLHRHHRRRRRNRRQESSDGLSSRFVKKLPQFKFSEPSTYT
FT                   RYESDCVVCFDGFRQGQWCRNLPGCGHVFHRKCVDTWLLKASTCPICRARVRLWEEDPQ
FT                   EGELWRCFGHRRSSLLDL"
     MPPTNNYRIS GEPPSTTPSH PPPKPKTRIL SLFLVGVIMF SIFFLFLVLI GIASVLILPL        60
     LLSSLHRHHR RRRRNRRQES SDGLSSRFVK KLPQFKFSEP STYTRYESDC VVCFDGFRQG       120
     QWCRNLPGCG HVFHRKCVDT WLLKASTCPI CRARVRLWEE DPQEGELWRC FGHRRSSLLD       180
     L                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page