(data stored in ACNUC13479 zone)

EMBL: AC005724.PE6

AC005724.PE6         Location/Qualifiers
FT   CDS             14767..15516
FT                   /codon_start=1
FT                   /gene="At2g18680"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9ZV50"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV50"
FT                   /protein_id="AAD08937.2"
FT                   /translation="MTDPNTPEFAAHLMRVFVDFRQFVNSLYIFIAVSSIINLLSTLVM
FT                   VHASALTHKDDSFEIKDFPILTLKYWKGPLVTNFYIVLFSLGYWFLFFIVLFSIVFFST
FT                   KLDSLAAKSRALFIVFAVFESYLAIVWNLSMVISILEDTYGIQALGKAAKIVKGMKPKL
FT                   FLLNLFFGLLSFGLVQILRLVDWSSSFSVTLTTGLVLMSSVFVVRMFQLVTYTVAYFQC
FT                   KSLQGQDSLRDVEYTKLSSTTLMGGLP"
     MTDPNTPEFA AHLMRVFVDF RQFVNSLYIF IAVSSIINLL STLVMVHASA LTHKDDSFEI        60
     KDFPILTLKY WKGPLVTNFY IVLFSLGYWF LFFIVLFSIV FFSTKLDSLA AKSRALFIVF       120
     AVFESYLAIV WNLSMVISIL EDTYGIQALG KAAKIVKGMK PKLFLLNLFF GLLSFGLVQI       180
     LRLVDWSSSF SVTLTTGLVL MSSVFVVRMF QLVTYTVAYF QCKSLQGQDS LRDVEYTKLS       240
     STTLMGGLP                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page