(data stored in ACNUC13479 zone)

EMBL: AC005724.PE7

AC005724.PE7         Location/Qualifiers
FT   CDS             17523..18491
FT                   /codon_start=1
FT                   /gene="At2g18690"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q9ZV49"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV49"
FT                   /protein_id="AAD08938.1"
FT                   /translation="MARFSFLNVVKDVVAILNESRKLFLKNKKLMFSVLVFPLLLNCLV
FT                   YFLNIFVIVPEITNLILEASLLPSTDPTSPEYAARLMRVFTDFRQFVGSSYIFAAVSSI
FT                   INLFSVLVIVHASAITLKDENFNIKDFPVLSLKSWKGPLVTYFYIALFSLGFGFLFFII
FT                   LCPILLFSIKSGSVENIGFLAVEAGVLLIIFTVSQSYFAIYWNLSMVISILEESYGFQA
FT                   LGKAAKIVKGMKTKLFLLNLFFGLLASGLAQILQLINMGRSLAVTLTTGFVLVCLVFAV
FT                   RMFQLVTYTVAYFQCKSLQGRDVESLRDVEYMALSSTTLTE"
     MARFSFLNVV KDVVAILNES RKLFLKNKKL MFSVLVFPLL LNCLVYFLNI FVIVPEITNL        60
     ILEASLLPST DPTSPEYAAR LMRVFTDFRQ FVGSSYIFAA VSSIINLFSV LVIVHASAIT       120
     LKDENFNIKD FPVLSLKSWK GPLVTYFYIA LFSLGFGFLF FIILCPILLF SIKSGSVENI       180
     GFLAVEAGVL LIIFTVSQSY FAIYWNLSMV ISILEESYGF QALGKAAKIV KGMKTKLFLL       240
     NLFFGLLASG LAQILQLINM GRSLAVTLTT GFVLVCLVFA VRMFQLVTYT VAYFQCKSLQ       300
     GRDVESLRDV EYMALSSTTL TE                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page