(data stored in ACNUC13479 zone)

EMBL: AC005724.PE9

AC005724.PE9         Location/Qualifiers
FT   CDS             complement(join(32104..32334,32441..32604,32692..32905,
FT                   32987..33672,33755..33912,34123..34325))
FT                   /codon_start=1
FT                   /gene="At2g18710"
FT                   /product="putative preprotein translocase SECY protein"
FT                   /db_xref="GOA:Q38885"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38885"
FT                   /protein_id="AAD08940.1"
FT                   /translation="MITVSEVSSYSSSSSNFASLSRLNHKSSSRLRSSSLYKGSFFSVS
FT                   TKTRRNTCKAKSWNLGLVINSRSSEASVFDPLGINPDETSGLSSIWESFVSLLSPSFES
FT                   SSGNRRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGV
FT                   NREAFVGNLDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPKLQDL
FT                   QKKEGEAGRKKILQYTRYASVGFAIVQAIGQVFYLRPYVNDFSTEWVVSSVTLLTLGSV
FT                   LTTYIGERISDLKLGNGTSLLIFTSIISYLPASFGRTTAEALQEGNYTGLGTIVVSFLL
FT                   LVLGIVYVQEAERKIPLNYASRYTSKAGGLQKSAYLPFKVNSAGVMPIIFSTSSLALPA
FT                   TLARFTGISALKNVAFALTPGGSFYLPTNILLIAFFNYYYTFLQLDPDDVSEQLKRQGA
FT                   SIPLVRPGKSTALFIKTVLGRISVLGSAFLAVLAAGPAVVEQITHLTAFRGFAGTSVLI
FT                   LVGCATDTARKVQAEIISQKYKNIEFYELDKYDP"
     MITVSEVSSY SSSSSNFASL SRLNHKSSSR LRSSSLYKGS FFSVSTKTRR NTCKAKSWNL        60
     GLVINSRSSE ASVFDPLGIN PDETSGLSSI WESFVSLLSP SFESSSGNRR DKPSSGRGVA       120
     AAIEDSSIDF GDFFKGPLPG KFLKLLGFLA LSRLGIYIPL GGVNREAFVG NLDQNSILST       180
     LDTFSGGGIG RLGICSLGIV PFINAQIVFQ LLAQVYPKLQ DLQKKEGEAG RKKILQYTRY       240
     ASVGFAIVQA IGQVFYLRPY VNDFSTEWVV SSVTLLTLGS VLTTYIGERI SDLKLGNGTS       300
     LLIFTSIISY LPASFGRTTA EALQEGNYTG LGTIVVSFLL LVLGIVYVQE AERKIPLNYA       360
     SRYTSKAGGL QKSAYLPFKV NSAGVMPIIF STSSLALPAT LARFTGISAL KNVAFALTPG       420
     GSFYLPTNIL LIAFFNYYYT FLQLDPDDVS EQLKRQGASI PLVRPGKSTA LFIKTVLGRI       480
     SVLGSAFLAV LAAGPAVVEQ ITHLTAFRGF AGTSVLILVG CATDTARKVQ AEIISQKYKN       540
     IEFYELDKYD P                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page