(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE2

ACAM1_2.PE2          Location/Qualifiers
FT   CDS             241..381
FT                   /locus_tag="AM1_A0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339654"
FT                   /db_xref="GeneID:5685411"
FT                   /translation="MLINPEDKQVEIYRPGQDVELLQSPSTISGADVLPEFSLNLEWIW
FT                   R"
FT                   /protein_id="YP_001520661.1"
     MLINPEDKQV EIYRPGQDVE LLQSPSTISG ADVLPEFSLN LEWIWR                       46
//

If you have problems or comments...

PBIL Back to PBIL home page