(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE4

ACAM1_2.PE4          Location/Qualifiers
FT   CDS             complement(533..1318)
FT                   /locus_tag="AM1_A0004"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339656"
FT                   /db_xref="GeneID:5685413"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAGYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELSHWVKTFSHHQNELAVVSEVVSF
FT                   EAEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALDVTGMNMLTVDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAVDRWEDLI"
FT                   /protein_id="YP_001520663.1"
     MKTLRWLIDL HPEFPASEIV AGYLRQHKKI EPIVIDRDDV MLGRWPDTED WIVGYGTMFA        60
     MTRLLRHPPL STAIFDDYSS LRCSKYYSYI YPFLGRAFLF APFGALPNLP LQRMFGDNIF       120
     VRSDTNYKLF PAEVLKTQEL SHWVKTFSHH QNELAVVSEV VSFEAEYRCF CRNGIFFCGS       180
     SYPDEPYSEV PQEIRSVAES VAQALDVTGM NMLTVDIGIH AGEPKLVEIG GVNSWGIYGS       240
     NVADFIAAME EEAVDRWEDL I                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page