(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE5

ACAM1_2.PE5          Location/Qualifiers
FT   CDS             complement(1515..2012)
FT                   /locus_tag="AM1_A0005"
FT                   /gene_family="HOG000291291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreB, putative"
FT                   /transl_table="11"
FT                   /note="Member of COG1077, Actin-like ATPases involved in
FT                   cell morphogenesis."
FT                   /db_xref="GI:158339657"
FT                   /db_xref="GeneID:5685414"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFSSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRVD
FT                   AT"
FT                   /protein_id="YP_001520664.1"
     MNLVQRLMGI FSEDLLIELT KSEVSITSFS SGATVKDKPL IAVSGEKNKL TVEGVGAECQ        60
     NMSKPGLQLI NPFDHSRSFV ANFTYAEKIL QYLIRKLLRN RLITSPRVII HQLEKNEGGL       120
     TEIEERVLRE LALGAGAREV IVFQGSKINT NVDTYQTIKQ RVDAT                       165
//

If you have problems or comments...

PBIL Back to PBIL home page