(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE6

ACAM1_2.PE6          Location/Qualifiers
FT   CDS             complement(2745..3191)
FT                   /locus_tag="AM1_A0006"
FT                   /gene_family="HOG000022977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339658"
FT                   /db_xref="GeneID:5685415"
FT                   /translation="MTQVLTAQFLFPAKEFDTQYGPRLNAKIKVANGEEAKLWGPPGDV
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQASAPGQAPVVGDAPLDDGALDGDTKSVIASYIS
FT                   NRAALYSFCYQEASRELGKHDASEETIKCAASTLFIAAQKKFGI"
FT                   /protein_id="YP_001520665.1"
     MTQVLTAQFL FPAKEFDTQY GPRLNAKIKV ANGEEAKLWG PPGDVALLAL RRGQTIQIAK        60
     DGKGKYSLVE QASAPGQAPV VGDAPLDDGA LDGDTKSVIA SYISNRAALY SFCYQEASRE       120
     LGKHDASEET IKCAASTLFI AAQKKFGI                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page