(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE7

ACAM1_2.PE7          Location/Qualifiers
FT   CDS             complement(3340..3681)
FT                   /locus_tag="AM1_A0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339659"
FT                   /db_xref="GeneID:5685416"
FT                   /translation="MDVQILEVLSIQLKVGDVLELTLVDEEFAPEQMIEIPIACKLVKS
FT                   DAILLHFHPHELELDLNTVDIHSKKDQRYLTVRSLEIVDTEKGYLATEDESGTARYQVM
FT                   WKKIANTYD"
FT                   /protein_id="YP_001520666.1"
     MDVQILEVLS IQLKVGDVLE LTLVDEEFAP EQMIEIPIAC KLVKSDAILL HFHPHELELD        60
     LNTVDIHSKK DQRYLTVRSL EIVDTEKGYL ATEDESGTAR YQVMWKKIAN TYD              113
//

If you have problems or comments...

PBIL Back to PBIL home page