(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE8

ACAM1_2.PE8          Location/Qualifiers
FT   CDS             complement(3724..3879)
FT                   /locus_tag="AM1_A0008"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339660"
FT                   /db_xref="GeneID:5685417"
FT                   /translation="MNIYVAQIEVWNGRTFQVIDFQMADNGESLGTVIREYVAAIGLRL
FT                   VYWCKL"
FT                   /protein_id="YP_001520667.1"
     MNIYVAQIEV WNGRTFQVID FQMADNGESL GTVIREYVAA IGLRLVYWCK L                 51
//

If you have problems or comments...

PBIL Back to PBIL home page