(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE1

ACAM1_4.PE1          Location/Qualifiers
FT   CDS             join(272785..273121,1..323)
FT                   /locus_tag="AM1_C0001"
FT                   /gene_family="HOG000135602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340456"
FT                   /db_xref="GeneID:5686041"
FT                   /translation="MGALGTELTSYSKNESQAKPVKEWGSVVTAYTIDFSPITKLTDEQ
FT                   FDLLCEANPEIKFERTPTGELVIMPPTGGETGRGNAKLTSRFVVWSERYGLGEVFDSST
FT                   CFRIPSGGDRSPDVAWVEKSRWDALTPEQQRKFPPICPDFVLELLSPSDNLTATQRKMQ
FT                   EYLTSGIRLGWLINPEDKQVEIYRPGQEVEVLQSPSSVSGEEVLLEFSLNLEWIWR"
FT                   /protein_id="YP_001521450.1"
     MGALGTELTS YSKNESQAKP VKEWGSVVTA YTIDFSPITK LTDEQFDLLC EANPEIKFER        60
     TPTGELVIMP PTGGETGRGN AKLTSRFVVW SERYGLGEVF DSSTCFRIPS GGDRSPDVAW       120
     VEKSRWDALT PEQQRKFPPI CPDFVLELLS PSDNLTATQR KMQEYLTSGI RLGWLINPED       180
     KQVEIYRPGQ EVEVLQSPSS VSGEEVLLEF SLNLEWIWR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page