(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE10

ACAM1_4.PE10         Location/Qualifiers
FT   CDS             complement(4853..5197)
FT                   /locus_tag="AM1_C0010"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340465"
FT                   /db_xref="GeneID:5686232"
FT                   /translation="MATIEATYASTIAQLNDEFRQGNHSLGRIFTTPGVDALSSEDQQE
FT                   LFRLVRTFDEFTEDNDPRGERDFGFIKFKGEVFNFKIDYYAPDMIHGSEDPEDLTITTR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001521459.1"
     MATIEATYAS TIAQLNDEFR QGNHSLGRIF TTPGVDALSS EDQQELFRLV RTFDEFTEDN        60
     DPRGERDFGF IKFKGEVFNF KIDYYAPDMI HGSEDPEDLT ITTRVLTLMH SSEY             114
//

If you have problems or comments...

PBIL Back to PBIL home page